FOXO4-DRI 10 mg

FOXO4-DRI is a synthetic cell-penetrating peptide of the D-retro-inverso (DRI) class, engineered as a research tool to interrogate the interaction between the forkhead box protein O4 (FOXO4) transcription factor and the tumor suppressor protein p53. It is a 46-residue peptide built entirely from D-amino acids in a reversed sequence, a design that confers high resistance to proteolytic degradation while preserving the spatial topology needed to engage its target. The molecule pairs a segment derived from the FOXO4 forkhead/transactivation interface with a poly-arginine cell-penetrating sequence, allowing it to cross cell membranes in experimental systems.

In preclinical and in-vitro studies, FOXO4-DRI has been investigated for its role in senolysis, the selective elimination of senescent ("zombie") cells. Foundational work from the de Keizer laboratory (Baar et al., Cell, 2017) reported that the peptide perturbs the FOXO4-p53 association, leading to p53 nuclear exclusion and apoptosis that appeared preferential to senescent cells in cultured cells and aged mouse models. Subsequent laboratory studies have explored its observed effects on senescent chondrocytes, endothelial cell senescence via p53 signaling, and senescent cancer-cell models. All such findings are research observations in cellular and animal systems and have not been established as human outcomes.

Researchers commonly use FOXO4-DRI as a probe for cellular senescence biology, p53 regulation, aging-associated pathways, and protein-protein interaction disruption. It is supplied here strictly as a reference material for in-vitro and laboratory investigation.

Specifications: CAS 2460055-10-9 · Molecular formula C228H388N86O64 · Molecular weight 5358.05 g/mol · Sequence (D-form) LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG (46 D-amino acid residues, D-retro-inverso) · Synonyms FOXO4 D-Retro-Inverso peptide, FOXO4 DRI, Proxofim · Purity >=98% (HPLC) · Form lyophilized powder · Available sizes Default

Storage & handling: Store the lyophilized powder at -20C and protect it from light. Reconstitute with bacteriostatic (BAC) water; keep the reconstituted solution refrigerated and use it within a few weeks. Avoid repeated freeze-thaw cycles.

For research use only. Not for human consumption. This product is not a drug, food, or dietary supplement and is not intended to diagnose, treat, cure, or prevent any disease.